GON4L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57405-25ul

Artikelnummer. 18643418

Beschreibung

GON4L Polyclonal specifically detects GON4L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spezifikation

• Antigen: GON4L
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: GON-4-like protein, GON4, GON-4, gon-4-like (C. elegans), RP11-101O6.1, RP11-243J18.4, YARP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54856
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GON4L
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVCMDSFQPMDDSLIAFQTRSKMPLKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKMWLGGLMNDDVGNEDE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human GON4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only