missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Golgin 97 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Golgin 97 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Golgin 97 Polyclonal specifically detects Golgin 97 in Human samples. It is validated for Western Blot.Specifications
| Golgin 97 | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers | |
| gap junction protein, alpha 4, 37kD, golgi autoantigen, golgin subfamily a, 1, golgin A1, Golgin subfamily A member 1, Golgin-97, MGC33154 | |
| GOLGA1 | |
| IgG | |
| 88 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_002068 | |
| 2800 | |
| Synthetic peptide directed towards the N terminal of human GOLGA1. Peptide sequence RPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title