missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GOLGA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-39007-25ul
This item is not returnable.
View return policy
Description
GOLGA5 Polyclonal specifically detects GOLGA5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| GOLGA5 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q8TBA6 | |
| GOLGA5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNS | |
| 25 μL | |
| Golgi Apparatus Markers | |
| 9950 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cell proliferation-inducing gene 31 protein, golgi autoantigen, golgin subfamily a, 5, golgin A5, Golgin subfamily A member 5, Golgin-84, GOLIM5, Protein Ret-II, PTC5, RET-fused gene 5 protein, ret-II, RETII, rfg5, RFG5golgi integral membrane protein 5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction