missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18373199

GNRPX Antibody, Novus Biologicals™

Product Code. 18373199 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373199 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18373199 Supplier Novus Biologicals Supplier No. H00055111B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

GNRPX Polyclonal antibody specifically detects GNRPX in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen GNRPX
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 to 1:2000, Immunocytochemistry/ Immunofluorescence 1:10 to 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_060519.1
Gene Alias FLJ10297,9530063M10Rik, GNRPX, guanine nucleotide releasing protein x, Guanine nucleotide-releasing protein x, PH domain-containing family J member 1, pleckstrin homology domain containing, family J member 1, pleckstrin homology domain-containing family J member 1
Host Species Mouse
Immunogen PLEKHJ1 (NP_060519.1, 1 a.a. - 149 a.a.) full-length human protein. MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA
Purification Method Protein G purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55111
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.