missing translation for 'onlineSavingsMsg'
Learn More

GNRH2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18364020 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18364020 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18364020 Supplier Novus Biologicals Supplier No. NBP2849940.1ML

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

GNRH2 Polyclonal specifically detects GNRH2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GNRH2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS, 2% Sucrose
Gene Alias GnRH-II, gonadotropin-releasing hormone 2, LH-RHII, luliberin II, luteinizing hormone-releasing hormone II, Progonadoliberin II, progonadoliberin-2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2797
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.