missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18336268

GnRH Antibody (4H3), Novus Biologicals™

Product Code. 18336268 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18336268 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18336268 Supplier Novus Biologicals Supplier No. H00002796M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

GnRH Monoclonal antibody specifically detects GnRH in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen GnRH
Applications Western Blot, ELISA
Classification Monoclonal
Clone 4H3
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000816
Gene Alias GNRH, GnRH-associated peptide 1, gonadotropin-releasing hormone 1 (leutinizing-releasing hormone), gonadotropin-releasing hormone 1 (luteinizing-releasing hormone), GRH, LHRH, LNRH, luliberin I, Progonadoliberin I, progonadoliberin-1, prolactin release-inhibiting factor
Host Species Mouse
Immunogen GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, GPCR
Primary or Secondary Primary
Gene ID (Entrez) 2796
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.