missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GNL3L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GNL3L |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
GNL3L Polyclonal specifically detects GNL3L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| GNL3L | |
| Unconjugated | |
| RUO | |
| EC 3.6.1, FLJ10613, guanine nucleotide binding protein-like 3 (nucleolar)-like, guanine nucleotide-binding protein-like 3-like protein, novel GTPase | |
| GNL3L | |
| IgG | |
| 65 kDa |
| Polyclonal | |
| Rabbit | |
| Q9NVN8 | |
| 54552 | |
| Synthetic peptides corresponding to GNL3L(guanine nucleotide binding protein-like 3 (nucleolar)-like) The peptide sequence was selected from the N terminal of GNL3L. Peptide sequence MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title