missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GNA11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35896-20ul
This item is not returnable.
View return policy
Description
GNA11 Polyclonal antibody specifically detects GNA11 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| GNA11 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GNA11 (NP_002058.2).,, Sequence:, ESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2767 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction