missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GMPS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | GMPS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.Specifications
| GMPS | |
| Polyclonal | |
| Rabbit | |
| P49915 | |
| 8833 | |
| Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein | |
| GMPS | |
| IgG | |
| 77 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title