GMPR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Código de producto	Marca	Quantity
18282672	Novus Biologicals NBP2-55842	100 μL
18674097	Novus Biologicals NBP2-55842-25ul	25 μL

Descripción

GMPR2 Polyclonal specifically detects GMPR2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Especificaciones

• Antigen: GMPR2
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Proteases & Other Enzymes
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51292
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
• Gene Symbols: GMPR2
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only