missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GMPPB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | GMPPB |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
GMPPB Polyclonal specifically detects GMPPB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GMPPB | |
| Polyclonal | |
| Purified | |
| RUO | |
| EC 2.7.7.13, GDP-mannose pyrophosphorylase BKIAA1851, GTP-mannose-1-phosphate guanylyltransferase beta, mannose-1-phosphate guanyltransferase beta, mannose-1-phosphate guanylyltransferase | |
| GMPPB | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q9Y5P6-2 | |
| 29925 | |
| Synthetic peptides corresponding to GMPPB(GDP-mannose pyrophosphorylase B) The peptide sequence was selected from the C terminal of GMPPB. Peptide sequence RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM. | |
| Primary | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title