missing translation for 'onlineSavingsMsg'
Learn More

GM-CSFR alpha Antibody, Novus Biologicals™

Product Code. 18381708 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18381708 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18381708 Supplier Novus Biologicals Supplier No. H00001438B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

GM-CSFR alpha Polyclonal antibody specifically detects GM-CSFR alpha in Human samples. It is validated for Western Blot, Flow Cytometry
TRUSTED_SUSTAINABILITY

Specifications

Antigen GM-CSFR alpha
Applications Western Blot, Flow Cytometry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Flow Cytometry
Formulation PBS (pH 7.4)
Gene Accession No. NP_006131.2
Gene Alias CD116, CD116 antigen, CDw116, colony stimulating factor 2 receptor alpha subunit, colony stimulating factor 2 receptor, alpha, low-affinity(granulocyte-macrophage), CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF receptor alpha subunit, GMCSFR, GM-CSF-R-alpha, GMCSFR-alpha, GMR, GMR-alpha, granulocyte-macrophage colony-stimulating factor receptor alpha chain, granulocyte-macrophage colony-stimulating factor receptor subunit alpha, MGC3848, MGC4838
Host Species Mouse
Immunogen CSF2RA (NP_006131.2, 1 a.a. - 400 a.a.) full-length human protein. MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 1438
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.