missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GlyT1/SLC6A9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £499.00
Specifications
| Antigen | GlyT1/SLC6A9 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18467870
|
Novus Biologicals
NBP1-81820-25ul |
25 μL |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18769493
|
Novus Biologicals
NBP1-81820 |
£499.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
GlyT1/SLC6A9 Polyclonal specifically detects GlyT1/SLC6A9 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| GlyT1/SLC6A9 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6536 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp547A1118, GlyT1, GlyT-1, GLYT1glyT-1, sodium- and chloride-dependent glycine transporter 1, solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Solute carrier family 6 member 9 | |
| SLC6A9 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title