missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GlyT1/SLC6A9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£388.00
Specifications
| Antigen | GlyT1/SLC6A9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GlyT1/SLC6A9 Polyclonal specifically detects GlyT1/SLC6A9 in Mouse samples. It is validated for Western Blot.Specifications
| GlyT1/SLC6A9 | |
| Polyclonal | |
| Rabbit | |
| P28571-1 | |
| 6536 | |
| Synthetic peptides corresponding to the C terminal of Slc6a9. Immunizing peptide sequence FQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGFE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547A1118, GlyT1, GlyT-1, GLYT1glyT-1, sodium- and chloride-dependent glycine transporter 1, solute carrier family 6 (neurotransmitter transporter, glycine), member 9, Solute carrier family 6 member 9 | |
| SLC6A9 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title