Glycogenin 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17719-100UL

Product Code. 18338156

Description

Glycogenin 1 Polyclonal antibody specifically detects Glycogenin 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Glycogenin 1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRP
• Quantity: 100 μg
• Research Discipline: metabolism
• Gene ID (Entrez): 2992
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified