missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glycogen phosphorylase, muscle form Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38607-100ul
This item is not returnable.
View return policy
Description
Glycogen phosphorylase, muscle form Polyclonal antibody specifically detects Glycogen phosphorylase, muscle form in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Glycogen phosphorylase, muscle form | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EC 2.4.1.1, glycogen phosphorylase, muscle form, myophosphorylase, phosphorylase, glycogen, muscle, phosphorylase, glycogen; muscle | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 743-842 of human Glycogen phosphorylase, muscle form (NP_005600.1).,, Sequence:, GMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI | |
| 100 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 5837 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction