missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glycine Receptor Alpha 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £443.00
Specifications
| Antigen | Glycine Receptor Alpha 1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18473501
|
Novus Biologicals
NBP1-86988-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18289866
|
Novus Biologicals
NBP1-86988 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glycine Receptor Alpha 1 Polyclonal specifically detects Glycine Receptor Alpha 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Glycine Receptor Alpha 1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| GLRA 1, Glycine receptor 48 kDa subunit, Glycine receptor strychnine-binding subunit, glycine receptor subunit alpha-1, glycine receptor, alpha 1, glycine receptor, alpha 1 (startle disease/hyperekplexia), MGC138878, MGC138879, STHE | |
| GLRA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Diabetes Research, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2741 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto