GLYAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54714

Product Code. 18297362

Description

GLYAT Polyclonal specifically detects GLYAT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GLYAT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ACGNATAAc, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, aralkyl-CoA N-acyltransferase, CATEC 2.3.1.13, GATHRP-1(CLP), glycine N-acyltransferase, glycine-N-acyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 10249
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q6IB77
• Gene Symbols: GLYAT
• Immunogen: Synthetic peptides corresponding to GLYAT(glycine-N-acyltransferase) The peptide sequence was selected from the N terminal of GLYAT. Peptide sequence HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG