Glutathione S-transferase Mu 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35584-100ul

Product Code. 30227959

Description

Glutathione S-transferase Mu 5 Polyclonal antibody specifically detects Glutathione S-transferase Mu 5 in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: Glutathione S-transferase Mu 5
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: EC 2.5.1.18, glutathione S-alkyltransferase M5, glutathione S-aralkyltransferase M5, glutathione S-aryltransferase M5, glutathione S-transferase M5, glutathione S-transferase mu 5, GST class-mu 5, GSTM5-5, GTM5, S-(hydroxyalkyl)glutathione lyase M5
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human Glutathione S-transferase Mu 5 (NP_000842.2).,, Sequence:, LENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 2949
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified