missing translation for 'onlineSavingsMsg'
Learn More

Glutathione S-transferase Mu 5 Antibody (1G4), Novus Biologicals™

Product Code. 18327378 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327378 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327378 Supplier Novus Biologicals Supplier No. H00002949M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Glutathione S-transferase Mu 5 Monoclonal antibody specifically detects Glutathione S-transferase Mu 5 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glutathione S-transferase Mu 5
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1G4
Conjugate Unconjugated
Dilution ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000842
Gene Alias EC 2.5.1.18, glutathione S-alkyltransferase M5, glutathione S-aralkyltransferase M5, glutathione S-aryltransferase M5, glutathione S-transferase M5, glutathione S-transferase mu 5, GST class-mu 5, GSTM5-5, GTM5, S-(hydroxyalkyl)glutathione lyase M5
Host Species Mouse
Immunogen GSTM5 (NP_000842, 145 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2949
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.