missing translation for 'onlineSavingsMsg'
Learn More

Glutaredoxin 2 Antibody, Novus Biologicals™

Product Code. 18382409 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18382409 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18382409 Supplier Novus Biologicals Supplier No. H00051022B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

Glutaredoxin 2 Polyclonal antibody specifically detects Glutaredoxin 2 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glutaredoxin 2
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. AAH28113
Gene Alias bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), glutaredoxin 2, glutaredoxin-2, mitochondrial, GRX2bA101E13.1
Host Species Mouse
Immunogen GLRX2 (AAH28113, 1 a.a. - 124 a.a.) full-length human protein. MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 51022
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.