Glutamate Receptor 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17081-100UL

Product Code. 18336526

Description

Glutamate Receptor 3 Polyclonal antibody specifically detects Glutamate Receptor 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Glutamate Receptor 3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: AMPA 3, AMPA-selective glutamate receptor 3, GluA3, GluR-3, GLUR-C, GLUR-K3, glutamate receptor C, glutamate receptor subunit 3, glutamate receptor, ionotrophic, AMPA 3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSEN
• Quantity: 100 μg
• Research Discipline: Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision
• Gene ID (Entrez): 2892
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified