missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Glutamate Dehydrogenase Recombinant Protein Antigen

Product Code. 18025086 Shop All Bio Techne Products
Change view
Click to view available options
Protein Length:
KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN
TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL
Unit Size:
0.10mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Protein Length Unit Size
18025086 KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN 0.1mL
18265663 TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”27950” to get your promotional price
Product Code. 18025086 Supplier Novus Biologicals™ Supplier No. NBP254700PEP
Stock Up and Save This Summer
Use promo code 27950
View all promotions
 Restricted Item
Estimated Shipment: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”27950” to get your promotional price

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutamate Dehydrogenase The Glutamate Dehydrogenase Recombinant Protein Antigen is derived from E. coli. The Glutamate Dehydrogenase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 2746
Protein Length KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name GLUD1 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias EC 1.4.1, EC 1.4.1.3, GDH 1, GDH, GDH1, GLUD
Gene Symbol GLUD1
Label Type Unlabeled
Molecular Weight (g/mol) 27 kDa
Product Type Recombinant Protein Antigen
Quantity 0.1 mL
Regulatory Status RUO
Source E.coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.