missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18226842

Glutamate Dehydrogenase Antibody, Novus Biologicals™

Product Code. 18226842 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18226842 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18226842 Supplier Novus Biologicals Supplier No. NBP154962

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Glutamate Dehydrogenase Polyclonal antibody specifically detects Glutamate Dehydrogenase in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glutamate Dehydrogenase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P00367
Gene Alias EC 1.4.1, EC 1.4.1.3, GDH, GDH 1, GDH1, GLUD, glutamate dehydrogenase (NAD(P)+), glutamate dehydrogenase 1, glutamate dehydrogenase 1, mitochondrial, MGC132003
Gene Symbols GLUD1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1 (NP_005262). Peptide sequence: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Diabetes Research, Mitochondrial Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 2746
Test Specificity Guinea pig: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.