missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutamate Dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-54962
This item is not returnable.
View return policy
Description
Glutamate Dehydrogenase Polyclonal antibody specifically detects Glutamate Dehydrogenase in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications
| Glutamate Dehydrogenase | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.4.1, EC 1.4.1.3, GDH, GDH 1, GDH1, GLUD, glutamate dehydrogenase (NAD(P)+), glutamate dehydrogenase 1, glutamate dehydrogenase 1, mitochondrial, MGC132003 | |
| Rabbit | |
| 56 kDa | |
| 100 μL | |
| Cellular Markers, Diabetes Research, Mitochondrial Markers, Neuroscience | |
| 2746 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| P00367 | |
| GLUD1 | |
| Synthetic peptides corresponding to GLUD1(glutamate dehydrogenase 1) The peptide sequence was selected from the N terminal of GLUD1 (NP_005262). Peptide sequence: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Guinea pig: 86%. | |
| Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction