missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09984-100UL
This item is not returnable.
View return policy
Description
Glut3 Polyclonal specifically detects Glut3 in Human samples. It is validated for Western Blot.
Specifications
| Glut3 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| FLJ90380, GLUT-3, GLUT3Glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3, solute carrier family 2, facilitated glucose transporter member 3 | |
| The immunogen is a synthetic peptide directed towards the middle region of human Glut3 (NP_008862.1). Peptide sequence VSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAG | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6515 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido