Glut3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09984-100UL

Product Code. 18334015

Description

Glut3 Polyclonal specifically detects Glut3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Glut3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ90380, GLUT-3, GLUT3Glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3, solute carrier family 2, facilitated glucose transporter member 3
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Glut3 (NP_008862.1). Peptide sequence VSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAG
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6515
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.