missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Glut2 Rabbit anti-Human, Mouse, Rat, Clone: 2V2U2, Novus Biologicals™

Glut2 Rabbit anti-Human, Mouse, Rat, Clone: 2V2U2, Novus Biologicals™

Product Code. 18331903
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18331903 20 μg 20µL
18389675 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18331903 Supplier Bio-Techne Supplier No. NBP31544320UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Glut2 Monoclonal antibody specifically detects Glut2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glut2
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 2V2U2
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias GLUT-2, GLUT2 Glucose transporter type 2, liver, SLC2A2, solute carrier family 2 (facilitated glucose transporter), member 2, solute carrier family 2, facilitated glucose transporter member 2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Glut2 (P11168). MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Stem Cell Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 6514
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.