GLUT10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18459061	Novus Biologicals NBP2-13326-25ul	25ul
18113530	Novus Biologicals NBP2-13326	0.1 mL

Description

GLUT10 Polyclonal specifically detects GLUT10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GLUT10
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: ATS, Glucose transporter type 10, GLUT-10, GLUT10MGC126706, solute carrier family 2 (facilitated glucose transporter), member 10, solute carrier family 2, facilitated glucose transporter member 10
• Gene Symbols: SLC2A10
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Diabetes Research
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 81031
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only