missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Glut1 Monoclonal antibody specifically detects Glut1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunoprecipitation
Specifications
Specifications
| Antigen | Glut1 |
| Applications | Western Blot, Immunoprecipitation |
| Classification | Monoclonal |
| Clone | 10O1I5 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunoprecipitation 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Choreoathetosis/Spasticity, Episodic (Paroxysmal Choreoathetosis), CSE, DYT17, DYT18, DYT9, EIG12, Glucose transporter type 1, erythrocyte/brain, GLUT-1, GLUT1DS, HepG2 glucose transporter, HTLVR, Human T-Cell Leukemia Virus (I and II) Receptor, MGC141895, MGC141896, PED, solute carrier family 2 (facilitated glucose transporter), member 1, Solute Carrier Family 2 Member 1, solute carrier family 2, facilitated glucose transporter member 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 393-492 of human Glut1 (P11166). ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?