missing translation for 'onlineSavingsMsg'
Learn More

Glut1 Rabbit anti-Human, Mouse, Rat, Clone: 10O1I5, Novus Biologicals™

Product Code. 18314576 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18314576 20 μg 20µL
18381392 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18314576 Supplier Novus Biologicals Supplier No. NBP31543320UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Glut1 Monoclonal antibody specifically detects Glut1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glut1
Applications Western Blot, Immunoprecipitation
Classification Monoclonal
Clone 10O1I5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunoprecipitation 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Choreoathetosis/Spasticity, Episodic (Paroxysmal Choreoathetosis), CSE, DYT17, DYT18, DYT9, EIG12, Glucose transporter type 1, erythrocyte/brain, GLUT-1, GLUT1DS, HepG2 glucose transporter, HTLVR, Human T-Cell Leukemia Virus (I and II) Receptor, MGC141895, MGC141896, PED, solute carrier family 2 (facilitated glucose transporter), member 1, Solute Carrier Family 2 Member 1, solute carrier family 2, facilitated glucose transporter member 1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 393-492 of human Glut1 (P11166). ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Cellular Markers, Diabetes Research, Lipid and Metabolism, Membrane Trafficking and Chaperones, Neuroscience, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6513
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.