missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Glucose 6 phosphate isomerase Polyclonal antibody specifically detects Glucose 6 phosphate isomerase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Glucose 6 phosphate isomerase |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?