GLTSCR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Marca:  Novus Biologicals NBP1-80905

Codice prodotto. 18290136

Descrizione

GLTSCR2 Polyclonal specifically detects GLTSCR2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifica

• Antigen: GLTSCR2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: glioma tumor suppressor candidate region gene 2, glioma tumor suppressor candidate region gene 2 protein, p60, PICT1, PICT-1, protein interacting with carboxyl terminus 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GLTSCR2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:REAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 29997
• Target Species: Human
• Isotype: IgG

For Research Use Only