missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLT6D1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GLT6D1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GLT6D1 Polyclonal specifically detects GLT6D1 in Human samples. It is validated for Western Blot.Specifications
| GLT6D1 | |
| Polyclonal | |
| Rabbit | |
| NP_892019 | |
| 360203 | |
| Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| galactosyltransferase family 6 domain containing 1, galactosyltransferase family 6 domain-containing 1, glycosyltransferase 6 domain containing 1, glycosyltransferase 6 domain-containing protein 1, GT6M7 | |
| GLT6D1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title