missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLT25D2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90712-25ul
This item is not returnable.
View return policy
Description
GLT25D2 Polyclonal specifically detects GLT25D2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| GLT25D2 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C1orf17, FLJ37771, FLJ37873, glycosyltransferase 25 domain containing 2, glycosyltransferase 25 family member 2, KIAA0584, procollagen galactosyltransferase 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23127 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GLT25D2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI | |
| 25 μL | |
| Primary | |
| Specificity of human GLT25D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction