missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GIT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35536-20ul
This item is not returnable.
View return policy
Description
GIT2 Polyclonal antibody specifically detects GIT2 in Human samples. It is validated for ELISA,Western Blot
Specifications
| GIT2 | |
| Polyclonal | |
| Western Blot 1:200 - 1:2000, ELISA | |
| ARF GAP GIT2, ARF GTPase-activating protein GIT2, CAT2, CAT-2, cool-associated, tyrosine phosphorylated protein 2, Cool-interacting tyrosine-phosphorylated protein 2, DKFZp686G01261, G protein-coupled receptor kinase interacting ArfGAP 2, G protein-coupled receptor kinase interactor 2, G protein-coupled receptor kinase-interactor 2, KIAA0148GRK-interacting protein 2, MGC760 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 450-510 of human GIT2 (NP_476511.1).,, Sequence:, ASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLP | |
| 20 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 9815 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction