GINS1, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Brand:  Abnova H00009837-B01P.50ug

Artikelnummer. 16154162

Beschreibung

Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS

Spezifikation

• Antigen: GINS1
• Classification: Polyclonal
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: BC012542
• Gene Symbols: GINS1
• Immunogen: GINS1 (AAH12542, 1 a.a. ∼ 196 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 9837
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Gene: GINS complex subunit 1 (Psf1 homolog)
• Gene Alias: KIAA0186/PSF1
• Host Species: Mouse
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody