GIMAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55099

Product Code. 18207423

Beskrivning

GIMAP1 Polyclonal specifically detects GIMAP1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifikationer

• Antigen: GIMAP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: GTPase IMAP family member 1, GTPase, IMAP family member 1, HIMAP1, IMAP1immunity associated protein 1, IMAP38, Immunity-associated protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 170575
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GIMAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SILGQRRFFSRLGATSVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only