missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GHRH Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33413-100ul
This item is not returnable.
View return policy
Description
GHRH Monoclonal antibody specifically detects GHRH in Human samples. It is validated for ELISA,Western Blot
Specifications
| GHRH | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| GHRFsomatocrinin, GRF, growth hormone releasing hormone, Growth hormone-releasing factor, Growth hormone-releasing hormone, INN, MGC119781, Sermorelin, Somatocrinin, somatoliberin, somatorelin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GHRH (NP_066567.1).,, Sequence:, MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQ | |
| 100 μL | |
| Cancer, GPCR | |
| 2691 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction