missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ghrelin/Obestatin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £410.00
Specifications
| Antigen | Ghrelin/Obestatin |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18462481
|
Novus Biologicals
NBP1-89773-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18290278
|
Novus Biologicals
NBP1-89773 |
0.1 mL |
£410.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ghrelin/Obestatin Polyclonal specifically detects Ghrelin/Obestatin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Ghrelin/Obestatin | |
| Polyclonal | |
| Rabbit | |
| Human | |
| appetite-regulating hormone, ghrelin, ghrelin/obestatin preprohormone, ghrelin/obestatin prepropeptide, Growth hormone secretagogue, Growth hormone-releasing peptide, Motilin-related peptide, MTLRPgrowth hormone secretagogue receptor ligand, obestatin, Protein M46 | |
| GHRL | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51738 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title