GHITM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49344-25ul

Product Code. 18673619

Description

GHITM Polyclonal antibody specifically detects GHITM in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: GHITM
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Dermal papilla-derived protein 2, DERP2MICS1, DKFZp566C0746, FLJ26584, growth hormone inducible transmembrane protein, growth hormone-inducible transmembrane protein, HSPC282, Mitochondrial morphology and cristae structure 1, PTD010, TMBIM5My021, transmembrane BAX inhibitor motif containing 5, Transmembrane BAX inhibitor motif-containing protein 5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRW
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27069
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG