GHITM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18449420	Novus Biologicals NBP1-84269-25ul	25 μL
18281488	Novus Biologicals NBP1-84269	0.1 mL

Description

GHITM Polyclonal specifically detects GHITM in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GHITM
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 27069
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Dermal papilla-derived protein 2, DERP2MICS1, DKFZp566C0746, FLJ26584, growth hormone inducible transmembrane protein, growth hormone-inducible transmembrane protein, HSPC282, Mitochondrial morphology and cristae structure 1, PTD010, TMBIM5My021, transmembrane BAX inhibitor motif containing 5, Transmembrane BAX inhibitor motif-containing protein 5
• Gene Symbols: GHITM
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only