missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GGT1 Antibody (1F9), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00002678-M01
This item is not returnable.
View return policy
Description
GGT1 Monoclonal antibody specifically detects GGT1 in Human, Mouse, Yeast samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), ELISA
Specifications
| GGT1 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| CD224, CD224 antigen, D22S672, D22S732, EC 2.3.2.2, gamma-glutamyl transpeptidase, gamma-glutamyltransferase 1MGC96904, gamma-glutamyltranspeptidase 1, GGT 1, GGTMGC96963, glutamyl transpeptidase, GTG, MGC96892 | |
| GGT1 (NP_005256, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG | |
| 0.1 mg | |
| Cancer | |
| 2678 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Sandwich ELISA | |
| 1F9 | |
| Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation 1:10 to 1:500, Immunohistochemistry-Paraffin 1:10 to 1:500, Sandwich ELISA 1:100 to 1:2000 | |
| NP_005256 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human, Mouse, Yeast | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction