missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GGA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57436-25ul
This item is not returnable.
View return policy
Description
GGA2 Polyclonal specifically detects GGA2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| GGA2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| FLJ20966, Gamma-adaptin-related protein 2, golgi associated, gamma adaptin ear containing, ARF binding protein 2, golgi-associated, gamma adaptin ear containing, ARF binding protein 2, Golgi-localized, gamma ear-containing, ARF-binding protein 2, KIAA1080ADP-ribosylation factor-binding protein GGA2, VEAR, VHS domain and ear domain of gamma-adaptin, VHS domain and ear domain-containing protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| GGA2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSPQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTP | |
| 25 μL | |
| Golgi Apparatus Markers, Membrane Trafficking and Chaperones | |
| 23062 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction