GFR alpha-2/GDNF R alpha-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18433821	Novus Biologicals NBP1-89778-25ul	25 μL
18269236	Novus Biologicals NBP1-89778	0.1 mL

Description

GFR alpha-2/GDNF R alpha-2 Polyclonal specifically detects GFR alpha-2/GDNF R alpha-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GFR alpha-2/GDNF R alpha-2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2675
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: GDNF family receptor alpha 2, GDNF family receptor alpha-2, GDNF receptor alpha-2, GDNF receptor beta, GDNFR-alpha-2, GDNFR-beta, GDNFRBRET ligand 2, GFR-alpha 2, GFR-alpha-2, glial cell line derived neurotrophic factor receptor, beta, Neurturin receptor alpha, NRTNR-alpha, NTNRA, NTNR-alpha, PI-linked cell-surface accessory protein, RETL2TGF-beta-related neurotrophic factor receptor 2, TGF-beta related neurotrophic factor receptor 2, TRN receptor, GPI-anchored, TRNR2NRTNR-ALPHA
• Gene Symbols: GFRA2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only