missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GFM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £571.00
Specifications
| Antigen | GFM1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639905
|
Novus Biologicals
NBP2-38221-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18103359
|
Novus Biologicals
NBP2-38221 |
0.1 mL |
£571.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GFM1 Polyclonal specifically detects GFM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GFM1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96RP9 | |
| 85476 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EFG, EFG1FLJ12662, EFGM, EF-Gmt, EGF1, FLJ13632, FLJ20773, G elongation factor, mitochondrial 1, G translation elongation factor, mitochondrial, GFMCOXPD1, hEFG1, mEF-G 1, mitochondrial, mitochondrial elongation factor G, mitochondrial elongation factor G1 | |
| GFM1 | |
| IgG | |
| Affinity Purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel