GFAP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-33774

Product Code. 18113603

Description

GFAP Polyclonal specifically detects GFAP in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GFAP
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: P14136
• Gene Symbols: GFAP
• Immunogen: This GFAP antibody was developed against a recombinant protein corresponding to amino acids: LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human GFAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ45472, GFAP astrocytes, glial fibrillary acidic protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 50 kDa
• Quantity: 0.1 mL
• Research Discipline: Astrocyte Markers, Cancer, Cell Biology, Cellular Markers, Chaperone Mediated Autophagy (CMA), Inflammation, Neurodegeneration, Neuroscience, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 2670
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only