missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Gemin 3 Antibody, Novus Biologicals™

Gemin 3 Antibody, Novus Biologicals™

Product Code. 18255288 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
25 μL
missing translation for 'unitSize'
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18255288 0.1 mL 0.1mL
18458600 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18255288 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP184058

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Gemin 3 Polyclonal specifically detects Gemin 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Gemin 3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Component of gems 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, DKFZp434H052, DP103DEAD-box protein DP103, EC 3.6.4.13, Gemin-3, GEMIN3gemin-3, probable ATP-dependent RNA helicase DDX20, SMN-interacting protein
Gene Symbols DDX20
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDH
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 11218
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.