GEFT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-14309-25ul

Product Code. 18463601

Description

GEFT Polyclonal specifically detects GEFT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GEFT
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: GEFTRAC/CDC42 exchange factor, Guanine nucleotide exchange factor GEFT, p63RhoGEFrho guanine nucleotide exchange factor 25, Rac/Cdc42/Rho exchange factor GEFT, Rho guanine nucleotide exchange factor (GEF) 25, RhoA/RAC/CDC42 exchange factor, RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 115557
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ARHGEF25
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYV
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only