GDF-9 Mouse anti-Human, Clone: GDF9/4261, Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP3-07273-100ug

Product Code. 18610197

Description

GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GDF-9
• Classification: Monoclonal
• Concentration: 0.2 mg/mL
• Dilution: Western Blot 1 to 2 μg/mL, ELISA, Immunohistochemistry-Paraffin 1 to 2 μg/mL
• Gene Alias: GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
• Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9.
• Quantity: 100 μg
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 2661
• Content And Storage: Store at 4°C.
• Isotype: IgG1

• Applications: Western Blot, ELISA, Immunohistochemistry (Paraffin)
• Clone: GDF9/4261
• Conjugate: Unconjugated
• Formulation: 10 mM PBS with 0.05% BSA
• Host Species: Mouse
• Purification Method: Protein A or G purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified