missing translation for 'onlineSavingsMsg'
Learn More

GDF-9 Antibody (GDF9/4261) - Azide and BSA Free, Novus Biologicals™

Product Code. 18380773 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18380773 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18380773 Supplier Novus Biologicals Supplier No. NBP308362

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GDF-9
Applications Western Blot, ELISA, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone GDF9/4261
Concentration 1 mg/mL
Conjugate Unconjugated
Dilution Western Blot : 1-2 ug/mL, ELISA, Immunohistochemistry-Paraffin : 1-2 ug/mL
Formulation 10mM PBS
Gene Alias GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Host Species Mouse
Immunogen Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9.
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 2661
Target Species Human
Content And Storage Store at -20 to -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.